ARL6IP6 Antibody

Images

 
Western Blot: ARL6IP6 Antibody [NBP1-81109] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: ARL6IP6 Antibody [NBP1-81109] - Staining of human cell line U-251 MG shows localization to nuclear membrane, cytosol and centrosome.
Immunohistochemistry-Paraffin: ARL6IP6 Antibody [NBP1-81109] - Staining in human placenta and pancreas tissues using anti-ARL6IP6 antibody. Corresponding ARL6IP6 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ARL6IP6 Antibody [NBP1-81109] - Staining of human duodenum shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: ARL6IP6 Antibody [NBP1-81109] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: ARL6IP6 Antibody [NBP1-81109] - Staining of human placenta shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARL6IP6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFP
Specificity
Specificity of human ARL6IP6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARL6IP6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARL6IP6 Protein (NBP1-81109PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARL6IP6 Antibody

  • ADP-ribosylation factor-like protein 6-interacting protein 6
  • ADP-ribosylation-like factor 6 interacting protein 6
  • ADP-ribosylation-like factor 6-interacting protein 6
  • aip-6
  • ARL-6-interacting protein 6
  • MGC33864
  • PFAAP1
  • Phosphonoformate immuno-associated protein 1
  • regulated by phosphonoformate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24748
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC-P
NBP1-81109
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ARL6IP6 Antibody (NBP1-81109) (0)

There are no publications for ARL6IP6 Antibody (NBP1-81109).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARL6IP6 Antibody (NBP1-81109) (0)

There are no reviews for ARL6IP6 Antibody (NBP1-81109). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ARL6IP6 Antibody (NBP1-81109) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ARL6IP6 Antibody (NBP1-81109)

Discover related pathways, diseases and genes to ARL6IP6 Antibody (NBP1-81109). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ARL6IP6 Antibody (NBP1-81109)

Discover more about diseases related to ARL6IP6 Antibody (NBP1-81109).

Blogs on ARL6IP6

There are no specific blogs for ARL6IP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARL6IP6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARL6IP6