ARHGAP42 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ARHGAP42 Antibody [NBP1-93869] - Staining of human cell line RT4 shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ARHGAP42 Antibody [NBP1-93869] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ARHGAP42 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DPSIPLPQPQSRSGSRRTRAICLSTGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIESLSSHSSEQNSTTKSASCQ
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ARHGAP42
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ARHGAP42 Protein (NBP1-93869PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ARHGAP42 Antibody

  • FLJ32810
  • Rho GTPase activating protein 42

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ARHGAP42 Antibody (NBP1-93869) (0)

There are no publications for ARHGAP42 Antibody (NBP1-93869).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ARHGAP42 Antibody (NBP1-93869) (0)

There are no reviews for ARHGAP42 Antibody (NBP1-93869). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ARHGAP42 Antibody (NBP1-93869) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ARHGAP42 Products

Bioinformatics Tool for ARHGAP42 Antibody (NBP1-93869)

Discover related pathways, diseases and genes to ARHGAP42 Antibody (NBP1-93869). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ARHGAP42

There are no specific blogs for ARHGAP42, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ARHGAP42 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ARHGAP42
Entrez
Uniprot