ARHGAP36 Antibody - BSA Free

Western Blot: ARHGAP36 Antibody [NBP1-93894] - Analysis in human cell line SH-SY5Y.

Immunocytochemistry/Immunofluorescence: ARHGAP36 Antibody [NBP1-93894] - Immunofluorescent staining of human cell line SH-SY5Y shows localization to nucleus & plasma membrane.

Immunohistochemistry-Paraffin: ARHGAP36 Antibody [NBP1-93894] - Staining of human skin shows no positivity in squamous epithelial cells as expected.

Immunohistochemistry-Paraffin: ARHGAP36 Antibody [NBP1-93894] - Staining of human adrenal gland shows high expression.

Immunohistochemistry-Paraffin: ARHGAP36 Antibody [NBP1-93894] - Staining of human pancreas shows low expression as expected.

Immunohistochemistry-Paraffin: ARHGAP36 Antibody [NBP1-93894] - Staining of human pituitary gland shows strong cytoplasmic positivity in cells in anterior lobe.

Immunohistochemistry-Paraffin: ARHGAP36 Antibody [NBP1-93894] - Staining in human adrenal gland and pancreas tissues using anti-ARHGAP36 antibody. Corresponding ARHGAP36 RNA-seq data are presented for the same tissues.

Immunohistochemistry: ARHGAP36 Antibody [NBP1-93894] - Analysis in human adrenal gland and kidney tissues. Corresponding ARHGAP36 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ARHGAP36 Antibody [NBP1-93894] - Staining of human adrenal gland shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: ARHGAP36 Antibody [NBP1-93894] - Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: ARHGAP36 Antibody [NBP1-93894] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: ARHGAP36 Antibody [NBP1-93894] - Staining of human pituitary gland shows strong cytoplasmic positivity in cells in anterior lobe.

Analysis in human cell line SH-SY5Y.

Analysis in human adrenal gland and kidney tissues using NBP1-93894 antibody. Corresponding ARHGAP36 RNA-seq data are presented for the same tissues.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ARHGAP36 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ARHGAP36 Antibody - BSA Free (NBP1-93894) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NWDVLFQVPPHIQRQVAKRVWKSSPEALDFIRRRNLRKIQSARIKMEEDALLSDPVETSAEARAAVLAQSKPSDEGSSEEPAVPSGTARSHDDEEGAGNPPIPEQD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ARHGAP36
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ARHGAP36 Protein (NBP1-93894PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ARHGAP36 Antibody - BSA Free

• FLJ30058
• Rho GTPase activating protein 36
• rho GTPase-activating protein 36

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for ARHGAP36 Antibody (NBP1-93894). (Showing 1 - 1 of 1 FAQ).

1. What did you use to stain? DAB?
   • Yes, the lab has stained with DAB.

Bioinformatics

• Gene Symbol: ARHGAP36
• Entrez:
  • 158763(Human)