archaemetzincin-1 Antibody

Images

 
Immunohistochemistry-Paraffin: archaemetzincin-1 Antibody [NBP1-91677] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, EM, Flow, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

archaemetzincin-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AIKEHERWLAMCIQALQREVAEEDLVQVDRAVDALDRWEMFTGQLPATRQDPPSSRDSVGLRKVLGDKFSSLRRKLSARKLARAESAPRPWDG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMZ1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Electron Microscopy
  • ELISA
  • Flow Cytometry
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval method is recommended. Use in ELISA reported in scientific literature (PMID: 30519544). Use in Flow and Electron Microscopy reported in scientific literature (PMID:30519544).
Control Peptide
archaemetzincin-1 Protein (NBP1-91677PEP)
Publications
Read Publication using
NBP1-91677 in the following applications:

  • EM
    1 publication
  • 1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for archaemetzincin-1 Antibody

  • archaelysin family metallopeptidase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85996
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-91677
Species: Hu
Applications: ELISA, EM, Flow, IHC, IHC-P

Publications for archaemetzincin-1 Antibody (NBP1-91677)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: EM, Flow.


Filter By Application
EM
(1)
Flow
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for archaemetzincin-1 Antibody (NBP1-91677) (0)

There are no reviews for archaemetzincin-1 Antibody (NBP1-91677). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for archaemetzincin-1 Antibody (NBP1-91677) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional archaemetzincin-1 Products

Bioinformatics Tool for archaemetzincin-1 Antibody (NBP1-91677)

Discover related pathways, diseases and genes to archaemetzincin-1 Antibody (NBP1-91677). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on archaemetzincin-1

There are no specific blogs for archaemetzincin-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our archaemetzincin-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMZ1
Entrez
Uniprot