AP000322.53 Antibody

Images

 
Immunohistochemistry-Paraffin: AP000322.53 Antibody [NBP1-91141] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AP000322.53 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NILRKNDKSLEDVYYSNLTSELKMTGLQGKVAKCSTLSISNRAVLQPCQAHLGAKGGSS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LOC388820
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AP000322.53 Protein (NBP1-91141PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AP000322.53 Antibody

  • LOC388820 uncharacterized LOC388820

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for AP000322.53 Antibody (NBP1-91141) (0)

There are no publications for AP000322.53 Antibody (NBP1-91141).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP000322.53 Antibody (NBP1-91141) (0)

There are no reviews for AP000322.53 Antibody (NBP1-91141). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for AP000322.53 Antibody (NBP1-91141) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional AP000322.53 Products

Bioinformatics Tool for AP000322.53 Antibody (NBP1-91141)

Discover related pathways, diseases and genes to AP000322.53 Antibody (NBP1-91141). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on AP000322.53

There are no specific blogs for AP000322.53, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AP000322.53 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LOC388820