ANKUB1 Antibody


Immunohistochemistry: C3orf16 Antibody [NBP2-30502] - Staining of human nasopharynx shows strong cytoplasmic positivity in subset of respiratory epithelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

ANKUB1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: EPFDVSADETVEVVKLMIKDYFHIPLSEDKQGRRYLELMYAGAALKDSWSLADVGISFCSTLKCFVKEEDKPTLYVFNAVTQ
Specificity of human C3orf16 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (80%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ANKUB1 Antibody

  • ANKUB1
  • Ankyrin Repeat And Ubiquitin Domain Containing 1
  • C3orf16
  • Chromosome 3 Open Reading Frame 16
  • Protein ANKUB1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ANKUB1 Antibody (NBP2-30502) (0)

There are no publications for ANKUB1 Antibody (NBP2-30502).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKUB1 Antibody (NBP2-30502) (0)

There are no reviews for ANKUB1 Antibody (NBP2-30502). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ANKUB1 Antibody (NBP2-30502) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ANKUB1 Products

Array NBP2-30502

Bioinformatics Tool for ANKUB1 Antibody (NBP2-30502)

Discover related pathways, diseases and genes to ANKUB1 Antibody (NBP2-30502). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ANKUB1

There are no specific blogs for ANKUB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ANKUB1 Antibody and receive a gift card or discount.


Gene Symbol ANKUB1