ANKRD65 Antibody

Images

 
Western Blot: ANKRD65 Antibody [NBP2-39062] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunocytochemistry/ Immunofluorescence: ANKRD65 Antibody [NBP2-39062] - Staining of human cell line RT4 shows localization to nucleoplasm. Antibody staining is shown in green.
Orthogonal Strategies: Immunohistochemistry-Paraffin: ANKRD65 Antibody [NBP2-39062] - Staining in human fallopian tube and kidney tissues using anti-ANKRD65 antibody. Corresponding ANKRD65 RNA-seq data are ...read more
Immunohistochemistry-Paraffin: ANKRD65 Antibody [NBP2-39062] - Staining of human fallopian tube shows high expression.
Immunohistochemistry-Paraffin: ANKRD65 Antibody [NBP2-39062] - Staining of human kidney shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

ANKRD65 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EEEQELRWMELDSEEALGTRTEGPSVVQGWGHLLQAVWRGPAGLVTQLLRQGH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD65
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ANKRD65 Protein (NBP2-39062PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD65 Antibody

  • ankyrin repeat domain 65
  • hypothetical protein LOC441869

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ANKRD65 Antibody (NBP2-39062) (0)

There are no publications for ANKRD65 Antibody (NBP2-39062).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD65 Antibody (NBP2-39062) (0)

There are no reviews for ANKRD65 Antibody (NBP2-39062). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ANKRD65 Antibody (NBP2-39062) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD65 Products

Bioinformatics Tool for ANKRD65 Antibody (NBP2-39062)

Discover related pathways, diseases and genes to ANKRD65 Antibody (NBP2-39062). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ANKRD65

There are no specific blogs for ANKRD65, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD65 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD65
Uniprot