ANKRD50 Antibody - BSA Free

Western Blot: ANKRD50 Antibody [NBP1-93594] - Analysis in human cell line RT-4.

Immunocytochemistry/Immunofluorescence: ANKRD50 Antibody [NBP1-93594] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.

Immunohistochemistry-Paraffin: ANKRD50 Antibody [NBP1-93594] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Western Blot: ANKRD50 Antibody [NBP1-93594] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4

Immunohistochemistry-Paraffin: ANKRD50 Antibody [NBP1-93594] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: ANKRD50 Antibody [NBP1-93594] - Analysis in human testis and liver tissues using NBP1-93594 antibody. Corresponding ANKRD50 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: ANKRD50 Antibody [NBP1-93594] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: ANKRD50 Antibody [NBP1-93594] - Staining of human lymph node shows no cytoplasmic positivity in germinal and non-germinal center cells.

Immunohistochemistry-Paraffin: ANKRD50 Antibody [NBP1-93594] - Staining of human testis shows strong cytoplasmic positivity in peritubular myoid cells and leydig cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ANKRD50 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CKIMIPSAQQEIGRSQQQFLIHQQSGEQKKRNGIMTNPNYHLQSNQVFLGRVSVPRTMQDRGHQEVLEGYPSSETELSLKQALKLQIEGSDPSFN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRD50
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 156 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  ANKRD50 Protein (NBP1-93594PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ANKRD50 Antibody - BSA Free

• ankyrin repeat domain 50

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKRD50
• Entrez:
  • 57182(Human)
• Uniprot:
  • Q9ULJ7(Human)