ANKRD50 Antibody

Images

 
Western Blot: ANKRD50 Antibody [NBP1-93594] - Analysis in human cell line RT-4.
Immunocytochemistry/ Immunofluorescence: ANKRD50 Antibody [NBP1-93594] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: ANKRD50 Antibody [NBP1-93594] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
Western Blot: ANKRD50 Antibody [NBP1-93594] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: ANKRD50 Antibody [NBP1-93594] - Staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
Immunohistochemistry-Paraffin: ANKRD50 Antibody [NBP1-93594] - Analysis in human testis and liver tissues using NBP1-93594 antibody. Corresponding ANKRD50 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: ANKRD50 Antibody [NBP1-93594] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: ANKRD50 Antibody [NBP1-93594] - Staining of human lymph node shows no cytoplasmic positivity in germinal and non-germinal center cells.
Immunohistochemistry-Paraffin: ANKRD50 Antibody [NBP1-93594] - Staining of human testis shows strong cytoplasmic positivity in peritubular myoid cells and leydig cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ANKRD50 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: CKIMIPSAQQEIGRSQQQFLIHQQSGEQKKRNGIMTNPNYHLQSNQVFLGRVSVPRTMQDRGHQEVLEGYPSSETELSLKQALKLQIEGSDPSFN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ANKRD50
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
156 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ANKRD50 Protein (NBP1-93594PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ANKRD50 Antibody

  • ankyrin repeat domain 50

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ANKRD50 Antibody (NBP1-93594) (0)

There are no publications for ANKRD50 Antibody (NBP1-93594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD50 Antibody (NBP1-93594) (0)

There are no reviews for ANKRD50 Antibody (NBP1-93594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ANKRD50 Antibody (NBP1-93594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ANKRD50 Products

Bioinformatics Tool for ANKRD50 Antibody (NBP1-93594)

Discover related pathways, diseases and genes to ANKRD50 Antibody (NBP1-93594). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ANKRD50

There are no specific blogs for ANKRD50, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ANKRD50 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANKRD50
Entrez
Uniprot