![Western Blot: ANKRD45 Antibody [NBP1-85422] - Analysis in control (vector only transfected HEK293T lysate) and ANKRD45 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/ANKRD45-Antibody-Western-Blot-NBP1-85422-img0010.jpg "Western Blot: ANKRD45 Antibody [NBP1-85422] - Analysis in control (vector only transfected HEK293T lysate) and ANKRD45 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit ANKRD45 Antibody - BSA Free (NBP1-85422) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: GYTLLHCAAAWGRLETLKALVELDVDIEALNFREERARDVAARYSQTECVEFLDWADARLTLKKYIAKVSLAVTDT |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ANKRD45 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ANKRD45 |
![Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining of human liver.](http://images.novusbio.com/fullsize/ANKRD45-Antibody-Immunohistochemistry-Paraffin-NBP1-85422-img0013.jpg "Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining of human liver.")
![Western Blot: ANKRD45 Antibody [NBP1-85422] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/ANKRD45-Antibody-Western-Blot-NBP1-85422-img0005.jpg "Western Blot: ANKRD45 Antibody [NBP1-85422] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining of human placenta shows low expression as expected.](http://images.novusbio.com/fullsize/ANKRD45-Antibody-Immunohistochemistry-Paraffin-NBP1-85422-img0007.jpg "Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining of human placenta shows low expression as expected.")
![Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining in human fallopian tube and placenta tissues using anti-ANKRD45 antibody. Corresponding ANKRD45 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ANKRD45-Antibody-Immunohistochemistry-Paraffin-NBP1-85422-img0008.jpg "Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining in human fallopian tube and placenta tissues using anti-ANKRD45 antibody. Corresponding ANKRD45 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining of human fallopian tube shows high expression.](http://images.novusbio.com/fullsize/ANKRD45-Antibody-Immunohistochemistry-Paraffin-NBP1-85422-img0009.jpg "Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining of human fallopian tube shows high expression.")
![Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining of human colon, fallopian tube, liver and testis using Anti-ANKRD45 antibody NBP1-85422 (A) shows similar protein distribution across tissues to independent antibody NBP1-85423 (B).](http://images.novusbio.com/fullsize/ANKRD45-Antibody-Immunohistochemistry-Paraffin-NBP1-85422-img0011.jpg "Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining of human colon, fallopian tube, liver and testis using Anti-ANKRD45 antibody NBP1-85422 (A) shows similar protein distribution across tissues to independent antibody NBP1-85423 (B).")
![Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining of human colon.](http://images.novusbio.com/fullsize/ANKRD45-Antibody-Immunohistochemistry-Paraffin-NBP1-85422-img0012.jpg "Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining of human colon.")
![Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining of human testis.](http://images.novusbio.com/fullsize/ANKRD45-Antibody-Immunohistochemistry-Paraffin-NBP1-85422-img0014.jpg "Immunohistochemistry-Paraffin: ANKRD45 Antibody [NBP1-85422] - Staining of human testis.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")