ANKRD16 Antibody

Immunocytochemistry/Immunofluorescence: ANKRD16 Antibody [NBP1-84178] - Staining of human cell line A549 shows localization to endoplasmic reticulum.

Immunohistochemistry-Paraffin: ANKRD16 Antibody [NBP1-84178] - Staining of human cerebellum shows positivity in purkinje cells and neuronal processes.

• Reactivity: Hu, Mu
• Applications: ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ANKRD16 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WTPLMMACTRKNLGVIQELVEHGANPLLKNKDGWNSFHIASREGDPLILQYLLTVCPGAWKTESKIRRTPLHTAAMHGHLEAVKVLL
• Predicted Species: Mouse (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRD16
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ANKRD16 Protein (NBP1-84178PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for ANKRD16 Antibody

• ankyrin repeat domain 16
• ankyrin repeat domain-containing protein 16
• DKFZP434N1511

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKRD16
• Entrez:
  • 54522(Human)
• Uniprot:
  • Q6P6B7(Human)