![Immunocytochemistry/Immunofluorescence: ANKRD13A Antibody [NBP1-89082] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.](http://images.novusbio.com/fullsize2/ANKRD13A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-89082-img0010.jpg "Immunocytochemistry/Immunofluorescence: ANKRD13A Antibody [NBP1-89082] - Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FGNVNGCSTAEESVSQNVEGTQADSASHITNFEVDQSVFEIPESYYVQDNGRNVHLQDEDYEIMQFAI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ANKRD13A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining of human tonsil.](http://images.novusbio.com/fullsize2/ANKRD13A-Antibody-Immunohistochemistry-Paraffin-NBP1-89082-img0016.jpg "Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining of human tonsil.")
![Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.](http://images.novusbio.com/fullsize2/ANKRD13A-Antibody-Immunohistochemistry-Paraffin-NBP1-89082-img0009.jpg "Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining of human tonsil shows strong cytoplasmic positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize2/ANKRD13A-Antibody-Immunohistochemistry-Paraffin-NBP1-89082-img0011.jpg "Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining of human testis shows high expression.](http://images.novusbio.com/fullsize2/ANKRD13A-Antibody-Immunohistochemistry-Paraffin-NBP1-89082-img0012.jpg "Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining of human testis shows high expression.")
![Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining in human testis and skeletal muscle tissues using anti-ANKRD13A antibody. Corresponding ANKRD13A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/ANKRD13A-Antibody-Immunohistochemistry-Paraffin-NBP1-89082-img0013.jpg "Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining in human testis and skeletal muscle tissues using anti-ANKRD13A antibody. Corresponding ANKRD13A RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining of human colon, skeletal muscle, testis and tonsil using Anti-ANKRD13A antibody NBP1-89082 (A) shows similar protein distribution across tissues to independent antibody NBP2-38505 (B).](http://images.novusbio.com/fullsize2/ANKRD13A-Antibody-Immunohistochemistry-Paraffin-NBP1-89082-img0014.jpg "Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining of human colon, skeletal muscle, testis and tonsil using Anti-ANKRD13A antibody NBP1-89082 (A) shows similar protein distribution across tissues to independent antibody NBP2-38505 (B).")
![Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining of human colon.](http://images.novusbio.com/fullsize2/ANKRD13A-Antibody-Immunohistochemistry-Paraffin-NBP1-89082-img0015.jpg "Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Staining of human colon.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")