ANKRD13A Antibody


Western Blot: ANKRD13A Antibody [NBP1-89082] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/ Immunofluorescence: ANKRD13A Antibody [NBP1-89082] - staining of human cell line A-431 shows positivity in plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ANKRD13A Antibody [NBP1-89082] - Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in reaction center cells.
Immunocytochemistry/ Immunofluorescence: ANKRD13A Antibody [NBP1-89082] - Staining of human cell line U-2 OS shows positivity in plasma membrane.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

ANKRD13A Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:FGNVNGCSTAEESVSQNVEGTQADSASHITNFEVDQSVFEIPESYYVQDNGRNVHLQDEDYEIMQFAI
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ANKRD13A Protein (NBP1-89082PEP)

Alternate Names for ANKRD13A Antibody

  • ANKRD13
  • ankyrin repeat domain 13
  • ankyrin repeat domain 13A
  • ankyrin repeat domain-containing protein 13A
  • NY-REN-25 antigen
  • NY-REN-25
  • Protein KE03


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ANKRD13A Antibody (NBP1-89082) (0)

There are no publications for ANKRD13A Antibody (NBP1-89082).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKRD13A Antibody (NBP1-89082) (0)

There are no reviews for ANKRD13A Antibody (NBP1-89082). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ANKRD13A Antibody (NBP1-89082) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ANKRD13A Antibody Products

Bioinformatics Tool for ANKRD13A Antibody (NBP1-89082)

Discover related pathways, diseases and genes to ANKRD13A Antibody (NBP1-89082). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ANKRD13A

There are no specific blogs for ANKRD13A, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol ANKRD13A

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-89082 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought