ANKDD1B Antibody


Immunohistochemistry-Paraffin: ANKDD1B Antibody [NBP2-32490] - Staining of human tonsil shows strong cytoplasmic positivity in non-germinal center cells.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

ANKDD1B Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: ATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAAERGHVEMIEKLTFLNLHTSE
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ANKDD1B Protein (NBP2-32490PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (81%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ANKDD1B Antibody

  • Ankyrin Repeat And Death Domain-Containing Protein 1B
  • Ankyrin Repeat And Death Domain-Containing Protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ANKDD1B Antibody (NBP2-32490) (0)

There are no publications for ANKDD1B Antibody (NBP2-32490).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ANKDD1B Antibody (NBP2-32490) (0)

There are no reviews for ANKDD1B Antibody (NBP2-32490). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ANKDD1B Antibody (NBP2-32490) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ANKDD1B Products

ANKDD1B NBP2-32490

Bioinformatics Tool for ANKDD1B Antibody (NBP2-32490)

Discover related pathways, diseases and genes to ANKDD1B Antibody (NBP2-32490). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ANKDD1B

There are no specific blogs for ANKDD1B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ANKDD1B Antibody and receive a gift card or discount.


Gene Symbol ANKDD1B