ALS2CR15 Antibody


Western Blot: ALS2CR15 Antibody [NBP1-90185] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: ALS2CR15 Antibody [NBP1-90185] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: ALS2CR15 Antibody [NBP1-90185] - Staining of human kidney shows strong granular cytoplasmic positivity in tubule cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

ALS2CR15 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SPSASLTSQEPSMGSEPLAHSSRFLPSQLFDLGFHVAGAFNNWVSQEESELCLSHTDNQPVPSQSPKKLTRSPNNGNQD
Specificity of human ALS2CR15 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
ALS2CR15 Protein (NBP1-90185PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for ALS2CR15 Antibody

  • ALS2CR14
  • ALS2CR15
  • amyotrophic lateral sclerosis 2 (juvenile) chromosome region, candidate 14
  • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 14 protein
  • Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 15 protein
  • candidate 15
  • DKFZp434E1919
  • Ica69-related protein
  • islet cell autoantigen 1,69kDa-like
  • islet cell autoantigen 1-like protein
  • MGC138440


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ALS2CR15 Antibody (NBP1-90185) (0)

There are no publications for ALS2CR15 Antibody (NBP1-90185).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALS2CR15 Antibody (NBP1-90185) (0)

There are no reviews for ALS2CR15 Antibody (NBP1-90185). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ALS2CR15 Antibody (NBP1-90185) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ALS2CR15 Products

Bioinformatics Tool for ALS2CR15 Antibody (NBP1-90185)

Discover related pathways, diseases and genes to ALS2CR15 Antibody (NBP1-90185). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for ALS2CR15 Antibody (NBP1-90185)

Find related products by research area.

Blogs on ALS2CR15

There are no specific blogs for ALS2CR15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ALS2CR15 Antibody and receive a gift card or discount.


Gene Symbol ICA1L