ACTL7B Antibody (6A4) - Azide and BSA Free

Western Blot: ACTL7B Antibody (6A4) [H00010880-M01] - ACTL7B monoclonal antibody (M01), clone 6A4 Analysis of ACTL7B expression in HeLa.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 6A4
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ACTL7B Antibody (6A4) - Azide and BSA Free Summary

• Immunogen: ACTL7B (NP_006677, 286 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERK
• Specificity: ACTL7B - actin-like 7B
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ACTL7B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACTL7B Antibody (6A4) - Azide and BSA Free

• actin-like 7B
• actin-like 7-beta
• actin-like protein 7B
• actin-like-7-beta
• Tact1

Background

The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene (ACTL7B), and related gene, ACTL7A, are intronless, and are located approximately 4 kb apart in a head-to-head orientation within the familial dysautonomia candidate region on 9q31. Based on mutational analysis of the ACTL7B gene in patients with this disorder, it was concluded that it is unlikely to be involved in the pathogenesis of dysautonomia. Unlike ACTL7A, the ACTL7B gene is expressed predominantly in the testis, however, its exact function is not known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACTL7B
• Entrez:
  • 10880(Human)
• OMIM:
  • 604304(Human)
• Uniprot:
  • NP_006677(Human)