ACSM4 Antibody

Images

 
Western Blot: ACSM4 Antibody [NBP2-82550] - Host: Rabbit. Target Name: ACSM4. Sample Tissue: Human COLO205 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACSM4 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ACSM4. Peptide sequence: EPITPDVTEKWRNKTGLDIYEGYGQTETVLICGNFKGMKIKPGSMGKPS The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ACSM4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACSM4 Antibody

  • ACSM4 acyl-CoA synthetase medium-chain family member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89283
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-82550
Species: Hu
Applications: WB

Publications for ACSM4 Antibody (NBP2-82550) (0)

There are no publications for ACSM4 Antibody (NBP2-82550).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACSM4 Antibody (NBP2-82550) (0)

There are no reviews for ACSM4 Antibody (NBP2-82550). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACSM4 Antibody (NBP2-82550) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACSM4 Products

Array NBP2-82550

Bioinformatics Tool for ACSM4 Antibody (NBP2-82550)

Discover related pathways, diseases and genes to ACSM4 Antibody (NBP2-82550). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACSM4 Antibody (NBP2-82550)

Discover more about diseases related to ACSM4 Antibody (NBP2-82550).
 

Pathways for ACSM4 Antibody (NBP2-82550)

View related products by pathway.

Blogs on ACSM4

There are no specific blogs for ACSM4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACSM4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACSM4