ZNF843 Antibody

Images

 
Western Blot: ZNF843 Antibody [NBP2-48599] - Analysis in control (vector only transfected HEK293T lysate) and LY403727 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry: ZNF843 Antibody [NBP2-48599] - Staining of human kidney shows strong cytoplasmic positivity in cells in glomeruli.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF843 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QLCCWLTKEHTLAEALRLSPVPAGFWGPVEADRPPANSHRRVCPFCCCSCGDSVNEKTSLSQRVLPHPGEKTCRGGSVESVSLA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF843
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ZNF843 Recombinant Protein Antigen (NBP2-48599PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF843 Antibody

  • MGC46336
  • zinc finger protein 843

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF843 Antibody (NBP2-48599) (0)

There are no publications for ZNF843 Antibody (NBP2-48599).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF843 Antibody (NBP2-48599) (0)

There are no reviews for ZNF843 Antibody (NBP2-48599). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF843 Antibody (NBP2-48599) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF843 Products

Bioinformatics Tool for ZNF843 Antibody (NBP2-48599)

Discover related pathways, diseases and genes to ZNF843 Antibody (NBP2-48599). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF843

There are no specific blogs for ZNF843, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF843 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF843