ZNF826P Antibody


Western Blot: ZNF826P Antibody [NBP1-91370] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ZNF826P Antibody Summary

Synthetic peptide directed towards the middle region of human FLJ44894. Peptide sequence HRRTHTGEKPYKCEECGKAFTASSTLSEYKTIHTGEKPCKCEECGKAFNW. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against FLJ44894 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF826P Antibody

  • ZNF826
  • ZNF826P zinc finger protein 826, pseudogene


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF826P Antibody (NBP1-91370) (0)

There are no publications for ZNF826P Antibody (NBP1-91370).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF826P Antibody (NBP1-91370) (0)

There are no reviews for ZNF826P Antibody (NBP1-91370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF826P Antibody (NBP1-91370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ZNF826P Products

Array NBP1-91370

Bioinformatics Tool for ZNF826P Antibody (NBP1-91370)

Discover related pathways, diseases and genes to ZNF826P Antibody (NBP1-91370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF826P

There are no specific blogs for ZNF826P, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF826P Antibody and receive a gift card or discount.


Gene Symbol FLJ44894