ZNF816A Antibody

Images

 
Western Blot: ZNF816A Antibody [NBP2-83910] - WB Suggested Anti-ZNF816A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:62500. Positive Control: HT1080 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF816A Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF816A. Peptide sequence: MEFSSTRHSITGEVIHTGTLQRHKSHHIGDFCFPEMKKDIHHFEFQWQEV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF816
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZNF816A Antibody

  • zinc finger protein 816
  • ZNF816A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41304
Species: Hu, Po, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF2334
Species: Hu
Applications: ICC, IHC, IP, WB
NBP2-29341
Species: Hu
Applications: PEP-ELISA, WB
MAB4158
Species: Hu
Applications: IHC
NBP2-75659
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-83910
Species: Hu
Applications: WB

Publications for ZNF816A Antibody (NBP2-83910) (0)

There are no publications for ZNF816A Antibody (NBP2-83910).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF816A Antibody (NBP2-83910) (0)

There are no reviews for ZNF816A Antibody (NBP2-83910). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF816A Antibody (NBP2-83910) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZNF816A Products

Bioinformatics Tool for ZNF816A Antibody (NBP2-83910)

Discover related pathways, diseases and genes to ZNF816A Antibody (NBP2-83910). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF816A

There are no specific blogs for ZNF816A, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF816A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF816