ZNF800 Antibody

Images

 
Western Blot: ZNF800 Antibody [NBP2-56679] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: ZNF800 Antibody [NBP2-56679] - Staining of human cell line U-251 MG shows localization to nucleus & nucleoli. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZNF800 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IRHITVVHKKSSRYLGKITASLEIRAIKKPIDFVLNKVAKRGPSRDEAKHSDSKHDGTSNSPSKKYEVADVGIEVKVTKNFSLHRCNKCGKAFAKKTYLEHHKKTHKANASNSPEGNKTK
Specificity
Specificity of human ZNF800 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZNF800
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ZNF800 Antibody

  • zinc finger protein 800

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF800 Antibody (NBP2-56679) (0)

There are no publications for ZNF800 Antibody (NBP2-56679).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF800 Antibody (NBP2-56679) (0)

There are no reviews for ZNF800 Antibody (NBP2-56679). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZNF800 Antibody (NBP2-56679) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZNF800 Products

Bioinformatics Tool for ZNF800 Antibody (NBP2-56679)

Discover related pathways, diseases and genes to ZNF800 Antibody (NBP2-56679). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF800

There are no specific blogs for ZNF800, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZNF800 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZNF800