ZNF786 Antibody

Western Blot: ZNF786 Antibody [NBP1-80405] - Human Lung

Immunohistochemistry-Paraffin: ZNF786 Antibody [NBP1-80405] - Human Lung Alveolar cells (indicated with arrows), 4-8ug/ml.

Western Blot: ZNF786 Antibody [NBP1-80405] - Titration: 1.25ug/ml Positive Control: HepG2 cell lysate.

• Reactivity: Hu
• Applications: WB, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ZNF786 Antibody Summary

• Immunogen: Synthetic peptide directed towards the N terminal of human ZNF786. Peptide sequence MAEPPRLPLTFEDVAIYFSEQEWQDLEAWQKELYKHVMRSNYETLVSLDD. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZNF786
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against ZNF786 and was validated on Western Blot and immunohistochemistry.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF786 Antibody

• DKFZp762I137
• MGC156120
• zinc finger protein 786

Background

ZNF786 may be involved in transcriptional regulation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZNF786
• Uniprot:
  • EAW80063(Human)