ZNF624 Antibody


Western Blot: ZNF624 Antibody [NBP1-79386] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ZNF624 Antibody Summary

Synthetic peptide directed towards the N terminal of human ZNF624The immunogen for this antibody is ZNF624. Peptide sequence MSLQDSTLSREGKPEGEIMAAVFFSVGRLSPEVTQPDEDLHLQAEETQLV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ZNF624 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF624 Antibody

  • KIAA1349MGC119602
  • MGC119603
  • MGC119605
  • zinc finger protein 624


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF624 Antibody (NBP1-79386) (0)

There are no publications for ZNF624 Antibody (NBP1-79386).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF624 Antibody (NBP1-79386) (0)

There are no reviews for ZNF624 Antibody (NBP1-79386). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF624 Antibody (NBP1-79386) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for ZNF624 Antibody (NBP1-79386)

Discover related pathways, diseases and genes to ZNF624 Antibody (NBP1-79386). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF624

There are no specific blogs for ZNF624, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF624 Antibody and receive a gift card or discount.


Gene Symbol ZNF624