ZNF578 Antibody


Western Blot: ZNF578 Antibody [NBP1-79370] - SH-SYSY cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ZNF578 Antibody Summary

Synthetic peptide directed towards the N terminal of human ZNF578The immunogen for this antibody is ZNF578. Peptide sequence EKDIHDFEFQSQKDERNGHEASMPKIKELMGSTDRHDQRHAGNKPIKDQL. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against ZNF578 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF578 Antibody

  • FLJ31384
  • zinc finger protein 578


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF578 Antibody (NBP1-79370) (0)

There are no publications for ZNF578 Antibody (NBP1-79370).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF578 Antibody (NBP1-79370) (0)

There are no reviews for ZNF578 Antibody (NBP1-79370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF578 Antibody (NBP1-79370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional ZNF578 Products

Array NBP1-79370

Bioinformatics Tool for ZNF578 Antibody (NBP1-79370)

Discover related pathways, diseases and genes to ZNF578 Antibody (NBP1-79370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF578

There are no specific blogs for ZNF578, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF578 Antibody and receive a gift card or discount.


Gene Symbol ZNF578