ZNF319 Antibody


Western Blot: ZNF319 Antibody [NBP1-79387] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

ZNF319 Antibody Summary

Synthetic peptide directed towards the N terminal of human ZNF319The immunogen for this antibody is ZNF319. Peptide sequence TLPPGTAENPLGCAVYGILLQPDPGLQPPQHAPLQAAGEPGPKCGVCGHD. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ZNF319 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZNF319 Antibody

  • Zinc finger and SCAN domain-containing protein 15
  • zinc finger protein 397
  • Zinc finger protein 47ZSCAN15MGC13250
  • ZNF47


ZNF319 may be involved in transcriptional regulation


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ZNF319 Antibody (NBP1-79387) (0)

There are no publications for ZNF319 Antibody (NBP1-79387).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZNF319 Antibody (NBP1-79387) (0)

There are no reviews for ZNF319 Antibody (NBP1-79387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ZNF319 Antibody (NBP1-79387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ZNF319 Products

Bioinformatics Tool for ZNF319 Antibody (NBP1-79387)

Discover related pathways, diseases and genes to ZNF319 Antibody (NBP1-79387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ZNF319

There are no specific blogs for ZNF319, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ZNF319 Antibody and receive a gift card or discount.


Gene Symbol ZNF319