ZDHHC24 Antibody

Western Blot: ZDHHC24 Antibody [NBP1-62198] - Titration: 0.2-1 ug/ml, Positive Control: Human Small Intestine.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

ZDHHC24 Antibody Summary

• Immunogen: Synthetic peptides corresponding to ZDHHC24(zinc finger, DHHC-type containing 24) The peptide sequence was selected form the middle region of ZDHHC24. Peptide sequence QHSYDLGPCHNLQAALGPRWALVWLWPFLASPLPGDGITFQTTADVGHTA. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ZDHHC24
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Application Notes: This is a rabbit polyclonal antibody against ZDHHC24 and was validated on Western blot.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ZDHHC24 Antibody

• DHHC-24
• EC 2.3.1.-
• probable palmitoyltransferase ZDHHC24
• Zinc finger DHHC domain-containing protein 24
• zinc finger, DHHC domain containing 24
• zinc finger, DHHC-type containing 24

Background

The specific function of the protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ZDHHC24
• OMIM:
  • NP_997223(Human)
• Uniprot:
  • Q6UX98(Human)