Novus Biologicals products are now on bio-techne.com

YTHD1 Antibody

Images

 
Western Blot: YTHD1 Antibody [NBP3-09349] - Western blot analysis of YTHD1 in Rat Thymus lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

YTHD1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat YTHD1 (NP_001019927). Peptide sequence PAFSAWGTSGSQGQQTQSSAYGSSYTYPPSSLGGTVVDGQTGFHSDTLNK
Clonality
Polyclonal
Host
Rabbit
Gene
YTHDF1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
61 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for YTHD1 Antibody

  • C20orf21
  • DACA-1
  • Dermatomyositis associated with cancer putative autoantigen 1
  • FLJ20391
  • YTH domain family 1
  • YTH domain family protein 1
  • YTH domain family, member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for YTHD1 Antibody (NBP3-09349) (0)

There are no publications for YTHD1 Antibody (NBP3-09349).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for YTHD1 Antibody (NBP3-09349) (0)

There are no reviews for YTHD1 Antibody (NBP3-09349). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for YTHD1 Antibody (NBP3-09349) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional YTHD1 Products

Research Areas for YTHD1 Antibody (NBP3-09349)

Find related products by research area.

Blogs on YTHD1

There are no specific blogs for YTHD1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our YTHD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YTHDF1