XTP12 Antibody


Western Blot: XTP12 Antibody [NBP1-90534] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: XTP12 Antibody [NBP1-90534] - Staining in human testis and pancreas tissues using anti-C6orf62 antibody. Corresponding C6orf62 RNA-seq data are presented for the same tissues.
Immunohistochemistry: XTP12 Antibody [NBP1-90534] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.
Immunohistochemistry-Paraffin: XTP12 Antibody [NBP1-90534] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: XTP12 Antibody [NBP1-90534] - Staining of human testis shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

XTP12 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NSRKKQALNRLRAQLRKKKESLADQFDFKMYIAFVFKEKKKKSALFEVSEVIPVMTNNYEENILKGVRDS
Specificity of human XTP12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Positive Control
XTP12 Lysate (NBP2-65166)
Control Peptide
XTP12 Protein (NBP1-90534PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for XTP12 Antibody

  • C6orf62
  • chromosome 6 open reading frame 62
  • dJ30M3.2
  • HBV X-transactivated protein 12
  • Nbla00237


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for XTP12 Antibody (NBP1-90534) (0)

There are no publications for XTP12 Antibody (NBP1-90534).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XTP12 Antibody (NBP1-90534) (0)

There are no reviews for XTP12 Antibody (NBP1-90534). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XTP12 Antibody (NBP1-90534) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional XTP12 Products

Bioinformatics Tool for XTP12 Antibody (NBP1-90534)

Discover related pathways, diseases and genes to XTP12 Antibody (NBP1-90534). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on XTP12

There are no specific blogs for XTP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our XTP12 Antibody and receive a gift card or discount.


Gene Symbol C6ORF62