XAGE1D Antibody


Western Blot: XAGE1D Antibody [NBP2-86898] - WB Suggested Anti-XAGE1D Antibody. Titration: 1.0 ug/ml. Positive Control: Fetal kidney

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

XAGE1D Antibody Summary

The immunogen is a synthetic peptide directed towards the C-terminal region of XAGE1D. Peptide sequence: QCATWKVICKSCISQTPGINLDLGSGVKVKIIPKEEHCKMPEAGEEQPQV The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified

Alternate Names for XAGE1D Antibody

  • cancer/testis associated protein
  • CT12.1C
  • CTP9
  • G antigen family D member 2
  • member 1c
  • X antigen family, member 1C
  • XAGE1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for XAGE1D Antibody (NBP2-86898) (0)

There are no publications for XAGE1D Antibody (NBP2-86898).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for XAGE1D Antibody (NBP2-86898) (0)

There are no reviews for XAGE1D Antibody (NBP2-86898). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for XAGE1D Antibody (NBP2-86898) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional XAGE1D Products

Bioinformatics Tool for XAGE1D Antibody (NBP2-86898)

Discover related pathways, diseases and genes to XAGE1D Antibody (NBP2-86898). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for XAGE1D Antibody (NBP2-86898)

Find related products by research area.

Blogs on XAGE1D

There are no specific blogs for XAGE1D, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our XAGE1D Antibody and receive a gift card or discount.


Gene Symbol XAGE1D