WDR89 Antibody

Images

 
Western Blot: WDR89 Antibody [NBP1-88413] - Analysis in human cell line RT-4.
Immunohistochemistry-Paraffin: WDR89 Antibody [NBP1-88413] - Staining of human duodenum shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

WDR89 Antibody Summary

Background
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DEGFYWWDLNHLDTDEPVTRLNIQDVREVVNMKEDALDYLIGGLYHEKTDTLHVIGGTNKGRIHLMNCSMSGLTHVTSLQGGHAATVRSFCWNVQDDSLLTGGEDAQLLLWKPGAIEKTFTKKESMKIASSVHQRVRVHSN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
WDR89
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
WDR89 Protein (NBP1-88413PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WDR89 Antibody

  • C14orf150
  • MGC9907
  • WD repeat domain 89
  • WD repeat-containing protein 89

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for WDR89 Antibody (NBP1-88413) (0)

There are no publications for WDR89 Antibody (NBP1-88413).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WDR89 Antibody (NBP1-88413) (0)

There are no reviews for WDR89 Antibody (NBP1-88413). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for WDR89 Antibody (NBP1-88413) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WDR89 Products

Bioinformatics Tool for WDR89 Antibody (NBP1-88413)

Discover related pathways, diseases and genes to WDR89 Antibody (NBP1-88413). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on WDR89

There are no specific blogs for WDR89, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WDR89 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR89