![Immunocytochemistry/Immunofluorescence: WDR54 Antibody [NBP2-38705] - Staining of human cell line MCF7 shows positivity in mitochondria and vesicles.](http://images.novusbio.com/fullsize/WDR54-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38705-img0001.jpg "Immunocytochemistry/Immunofluorescence: WDR54 Antibody [NBP2-38705] - Staining of human cell line MCF7 shows positivity in mitochondria and vesicles.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: TTGNLHVQINAHARAICALDLASEVGKLLSAGEDTFVHIWKLSRNPESGYIEVEHCHGECVADTQLCGARFCDSSGNSFAVTGYDL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | WDR54 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: WDR54 Antibody [NBP2-38705] - Staining of human kidney.](http://images.novusbio.com/fullsize/WDR54-Antibody-Immunohistochemistry-Paraffin-NBP2-38705-img0007.jpg "Immunohistochemistry-Paraffin: WDR54 Antibody [NBP2-38705] - Staining of human kidney.")
![Immunohistochemistry: WDR54 Antibody [NBP2-38705] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/WDR54-Antibody-Immunohistochemistry-NBP2-38705-img0002.jpg "Immunohistochemistry: WDR54 Antibody [NBP2-38705] - Staining of human fallopian tube shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: WDR54 Antibody [NBP2-38705] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/WDR54-Antibody-Immunohistochemistry-Paraffin-NBP2-38705-img0003.jpg "Immunohistochemistry-Paraffin: WDR54 Antibody [NBP2-38705] - Staining of human liver shows low expression as expected.")
![Immunohistochemistry-Paraffin: WDR54 Antibody [NBP2-38705] - Staining in human fallopian tube and liver tissues using anti-WDR54 antibody. Corresponding WDR54 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/WDR54-Antibody-Immunohistochemistry-Paraffin-NBP2-38705-img0004.jpg "Immunohistochemistry-Paraffin: WDR54 Antibody [NBP2-38705] - Staining in human fallopian tube and liver tissues using anti-WDR54 antibody. Corresponding WDR54 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: WDR54 Antibody [NBP2-38705] - Staining of human cerebral cortex, fallopian tube, kidney and liver using Anti-WDR54 antibody NBP2-38705 (A) shows similar protein distribution across tissues to independent antibody NBP1-82275 (B).](http://images.novusbio.com/fullsize/WDR54-Antibody-Immunohistochemistry-Paraffin-NBP2-38705-img0005.jpg "Immunohistochemistry-Paraffin: WDR54 Antibody [NBP2-38705] - Staining of human cerebral cortex, fallopian tube, kidney and liver using Anti-WDR54 antibody NBP2-38705 (A) shows similar protein distribution across tissues to independent antibody NBP1-82275 (B).")
![Immunohistochemistry-Paraffin: WDR54 Antibody [NBP2-38705] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/WDR54-Antibody-Immunohistochemistry-Paraffin-NBP2-38705-img0006.jpg "Immunohistochemistry-Paraffin: WDR54 Antibody [NBP2-38705] - Staining of human cerebral cortex.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")