WBSCR27 Antibody

Western Blot: FRMD5 Antibody [NBP1-81206] - Analysis in human cell lines U-251MG and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.

Staining of human cell line A-431 shows localization to focal adhesion sites.

Product Discontinued

WBSCR27 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LTTRTNSSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWRWYPASLPRMASSPALSTCTESG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: METTL27
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for WBSCR27 Antibody

• MGC40131
• Williams Beuren syndrome chromosome region 27
• Williams-Beuren syndrome chromosomal region 27 protein

Background

WBSCR27 encodes a protein belonging to ubiE/COQ5 methyltransferase family. The gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.22-q11.23. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: METTL27