We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

WBSCR27 Antibody

Images

 
Western Blot: FRMD5 Antibody [NBP1-81206] - Analysis in human cell lines U-251MG and MCF-7. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Staining of human cell line A-431 shows localization to focal adhesion sites.

Product Details

Summary
Product Discontinued
View other related WBSCR27 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-86008
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

WBSCR27 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LTTRTNSSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWRWYPASLPRMASSPALSTCTESG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
METTL27
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for WBSCR27 Antibody

  • MGC40131
  • Williams Beuren syndrome chromosome region 27
  • Williams-Beuren syndrome chromosomal region 27 protein

Background

WBSCR27 encodes a protein belonging to ubiE/COQ5 methyltransferase family. The gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.22-q11.23. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92604
Species: Hu
Applications: IHC,  IHC-P, WB
NBP3-47991
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NB100-56472
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-86008
Species: Hu
Applications: WB, ICC/IF

Publications for WBSCR27 Antibody (NBP1-86008) (0)

There are no publications for WBSCR27 Antibody (NBP1-86008).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for WBSCR27 Antibody (NBP1-86008) (0)

There are no reviews for WBSCR27 Antibody (NBP1-86008). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for WBSCR27 Antibody (NBP1-86008) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional WBSCR27 Products

Research Areas for WBSCR27 Antibody (NBP1-86008)

Find related products by research area.

Blogs on WBSCR27

There are no specific blogs for WBSCR27, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our WBSCR27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL27