VSTM2L Antibody

Images

 
Western Blot: VSTM2L Antibody [NBP1-92577] - Analysis in control (vector only transfected HEK293T lysate) and VSTM2L over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunohistochemistry-Paraffin: VSTM2L Antibody [NBP1-92577] - Staining of human urinary bladder shows moderate cytoplasmic and nuclear positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

VSTM2L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QWWYVRSHRDWTDKQAWASNQLKASQQEDAGKEATKISVVKVVGSNISHKLRLSRVKPTDEGTYEC
Predicted Species
Mouse (94%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
VSTM2L
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
VSTM2L Protein (NBP1-92577PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for VSTM2L Antibody

  • C20orf102
  • chromosome 20 open reading frame 102
  • dJ1118M15.2
  • Gm691
  • V-set and transmembrane domain containing 2 like
  • V-set and transmembrane domain-containing protein 2-like protein
  • VSTM2L

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for VSTM2L Antibody (NBP1-92577) (0)

There are no publications for VSTM2L Antibody (NBP1-92577).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VSTM2L Antibody (NBP1-92577) (0)

There are no reviews for VSTM2L Antibody (NBP1-92577). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for VSTM2L Antibody (NBP1-92577) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional VSTM2L Products

Bioinformatics Tool for VSTM2L Antibody (NBP1-92577)

Discover related pathways, diseases and genes to VSTM2L Antibody (NBP1-92577). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VSTM2L Antibody (NBP1-92577)

Discover more about diseases related to VSTM2L Antibody (NBP1-92577).
 

Pathways for VSTM2L Antibody (NBP1-92577)

View related products by pathway.

Blogs on VSTM2L

There are no specific blogs for VSTM2L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our VSTM2L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol VSTM2L