![Western Blot: UBTD2 Antibody [NBP2-38270] - Analysis in control (vector only transfected HEK293T lysate) and UBTD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize2/UBTD2-Antibody-Western-Blot-NBP2-38270-img0003.jpg "Western Blot: UBTD2 Antibody [NBP2-38270] - Analysis in control (vector only transfected HEK293T lysate) and UBTD2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: QLPVYCLAPPINMIEEKSDIETLDIPEPPPNSGYECQLRLRLSTGKDLKLVVRSTD |
| Predicted Species | Mouse (95%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | UBTD2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Pathways for UBTD2 Antibody (NBP2-38270)View related products by pathway.
|
PTMs for UBTD2 Antibody (NBP2-38270)Learn more about PTMs related to UBTD2 Antibody (NBP2-38270).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: UBTD2 Antibody [NBP2-38270] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/UBTD2-Antibody-Immunohistochemistry-Paraffin-NBP2-38270-img0007.jpg "Immunohistochemistry-Paraffin: UBTD2 Antibody [NBP2-38270] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: UBTD2 Antibody [NBP2-38270] - Staining of human cervix, uterine shows moderate cytoplasmic positivity in squamous epithelial cells.](http://images.novusbio.com/fullsize2/UBTD2-Antibody-Immunohistochemistry-Paraffin-NBP2-38270-img0004.jpg "Immunohistochemistry-Paraffin: UBTD2 Antibody [NBP2-38270] - Staining of human cervix, uterine shows moderate cytoplasmic positivity in squamous epithelial cells.")
![Immunohistochemistry-Paraffin: UBTD2 Antibody [NBP2-38270] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize2/UBTD2-Antibody-Immunohistochemistry-Paraffin-NBP2-38270-img0005.jpg "Immunohistochemistry-Paraffin: UBTD2 Antibody [NBP2-38270] - Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: UBTD2 Antibody [NBP2-38270] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/UBTD2-Antibody-Immunohistochemistry-Paraffin-NBP2-38270-img0006.jpg "Immunohistochemistry-Paraffin: UBTD2 Antibody [NBP2-38270] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")