TTC6 Antibody


Western Blot: TTC6 Antibody [NBP1-54927] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TTC6 Antibody Summary

Synthetic peptides corresponding to TTC6(tetratricopeptide repeat domain 6) The peptide sequence was selected from the C terminal of TTC6. Peptide sequence MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY. The peptide sequence for this immunogen was taken from within the described region.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against TTC6 and was validated on Western blot.
Theoretical MW
59 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TTC6 Antibody

  • C14orf25
  • NCRNA00291
  • TTC6 tetratricopeptide repeat domain 6


The functions of TTC6 remain unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TTC6 Antibody (NBP1-54927) (0)

There are no publications for TTC6 Antibody (NBP1-54927).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TTC6 Antibody (NBP1-54927) (0)

There are no reviews for TTC6 Antibody (NBP1-54927). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TTC6 Antibody (NBP1-54927) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TTC6 Products

Array NBP1-54927

Bioinformatics Tool for TTC6 Antibody (NBP1-54927)

Discover related pathways, diseases and genes to TTC6 Antibody (NBP1-54927). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TTC6

There are no specific blogs for TTC6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TTC6 Antibody and receive a gift card or discount.


Gene Symbol TTC6