![Western Blot: TSPYL4 Antibody [H00023270-B01P] - Analysis of TSPYL4 expression in transfected 293T cell line by TSPYL4 polyclonal antibody. Lane 1: TSPYL4 transfected lysate(23.21 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/TSPYL4-Antibody-Western-Blot-H00023270-B01P-img0002.jpg "Western Blot: TSPYL4 Antibody [H00023270-B01P] - Analysis of TSPYL4 expression in transfected 293T cell line by TSPYL4 polyclonal antibody. Lane 1: TSPYL4 transfected lysate(23.21 KDa). Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse TSPYL4 Antibody - Azide and BSA Free (H00023270-B01P) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | TSPYL4 (AAH09116.1, 1 a.a. - 211 a.a.) full-length human protein. MDSLEAIDQELSNVNAQADRAFLQLERKFGRMRRLHMQRRSFIIQNIPGFWVTAFRNHPQLSPMISGQDEDMLRYMINLEVEELKHPRAGCKFKFIFQGNPYFRNEGLVKEYERRSSGRVVSLSTPIRWHRGQDPQAHIHRNREGNTIPSFFNWFSDHSLLEFDRIAEIIKGELWPNPLQYYLMGEGPRRGIRGPPRQPVESARSFRFQSG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | TSPYL4 |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | This antibody is useful for Western Blot, Functional, Immunofluorescence |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Protocadherin-10 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Protocadherin-10 [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TSPYL4 |
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: TSPYL4 Antibody [H00023270-B01P] - Analysis of purified antibody to TSPYL4 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/TSPYL4-Antibody-Immunocytochemistry-Immunofluorescence-H00023270-B01P-img0001.jpg "Immunocytochemistry/Immunofluorescence: TSPYL4 Antibody [H00023270-B01P] - Analysis of purified antibody to TSPYL4 on HeLa cell. (antibody concentration 10 ug/ml)")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")