![Sandwich ELISA: TP53TG5 Antibody (3C2) [H00027296-M01] - Detection limit for recombinant GST tagged TP53TG5 is 1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/TP53TG5-Antibody-3C2-Sandwich-ELISA-H00027296-M01-img0001.jpg "Sandwich ELISA: TP53TG5 Antibody (3C2) [H00027296-M01] - Detection limit for recombinant GST tagged TP53TG5 is 1 ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | ELISA |
| Clone | 3C2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Mouse TP53TG5 Antibody (3C2) - Azide and BSA Free (H00027296-M01) is a monoclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | C20orf10 (AAH36785, 191 a.a. ~ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RNRTPMGHMKQLDVADQWIWFEGLPTRIHLPAPRVMCRSSTLRWVKRRCTRFCSASLEMPMWHPYKVDVTWTRARGASRGWRSRHQLKGRNGWRNSRVYK |
| Specificity | C20orf10 - chromosome 20 open reading frame 10 |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TP53TG5 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactive against recombinant protein on ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TP53TG5 Antibody (H00027296-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
