TMEM63A Antibody

Images

 
Western Blot: TMEM63A Antibody [NBP1-69249] - This Anti-TMEM63A antibody was used in Western Blot of 293T tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM63A Antibody Summary

Immunogen
Synthetic peptides corresponding to TMEM63A(transmembrane protein 63A) The peptide sequence was selected from the N terminal of TMEM63A. Peptide sequence MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM63A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMEM63A and was validated on Western blot.
Theoretical MW
89 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM63A Antibody

  • KIAA0792KIAA0489
  • transmembrane protein 63A

Background

TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM63A Antibody (NBP1-69249) (0)

There are no publications for TMEM63A Antibody (NBP1-69249).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM63A Antibody (NBP1-69249) (0)

There are no reviews for TMEM63A Antibody (NBP1-69249). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM63A Antibody (NBP1-69249) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM63A Products

Bioinformatics Tool for TMEM63A Antibody (NBP1-69249)

Discover related pathways, diseases and genes to TMEM63A Antibody (NBP1-69249). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM63A

There are no specific blogs for TMEM63A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM63A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM63A
Uniprot