TMEM41B Recombinant Protein Antigen

Images

 
There are currently no images for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TMEM41B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMEM41B.

Source: E. coli

Amino Acid Sequence: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TMEM41B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81552. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TMEM41B Recombinant Protein Antigen

  • KIAA0033
  • KIAA0033MGC33897
  • MGC57262
  • Stasimon
  • TMEM41B
  • transmembrane protein 41B

Background

Transmembrane protein 41B/Stasimon (human TMEM41B theoretical molecular weight 32.5 kDa) is an integral endoplasmic reticulum membrane protein that plays a role in autophagy and neurogenesis (1). TMEM41B forms a complex with vacuole membrane protein 1 (VMP1) and is required for autophagosome formation. Similar to VMP1, TMEM41B contains a VTT domain. Expression of TMEM41B/Stasimon restores motor neuron function defects in Drosophila and zebrafish models of spinal muscular atrophy (SMA). Survival motor neuron protein (SMN) deficiency, which underscores the neuromuscular disorder SMA, affects TMEM41B/Stasimon U12 splicing and mRNA expression (2,3). 1. Stavoe, A. K. H., & Holzbaur, E. L. F. (2019). Autophagy in Neurons. Annual Review of Cell and Developmental Biology. https://doi.org/10.1146/annurev-cellbio-100818-125242 2. Doktor, T. K., Hua, Y., Andersen, H. S., Br0ner, S., Liu, Y. H., Wieckowska, A., Andresen, B. S. (2017). RNA-sequencing of a mouse-model of spinal muscular atrophy reveals tissue-wide changes in splicing of U12-dependent introns. Nucleic Acids Research. https://doi.org/10.1093/nar/gkw731 3. Hosseinibarkooie, S., Schneider, S., & Wirth, B. (2017). Advances in understanding the role of disease-associated proteins in spinal muscular atrophy. Expert Review of Proteomics. https://doi.org/10.1080/14789450.2017.1345631

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1936
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
H00006607-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-83280
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NBP1-76798
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KO, WB

Publications for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP) (0)

There are no publications for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP) (0)

There are no reviews for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMEM41B Products

Research Areas for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP)

Find related products by research area.

Blogs on TMEM41B

There are no specific blogs for TMEM41B, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TMEM41B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM41B