TMEM41B Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMEM41B. Source: E. coli
Amino Acid Sequence: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TMEM41B |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81552. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
23 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TMEM41B Recombinant Protein Antigen
Background
Transmembrane protein 41B/Stasimon (human TMEM41B theoretical molecular weight 32.5 kDa) is an integral endoplasmic reticulum membrane protein that plays a role in autophagy and neurogenesis (1). TMEM41B forms a complex with vacuole membrane protein 1 (VMP1) and is required for autophagosome formation. Similar to VMP1, TMEM41B contains a VTT domain. Expression of TMEM41B/Stasimon restores motor neuron function defects in Drosophila and zebrafish models of spinal muscular atrophy (SMA). Survival motor neuron protein (SMN) deficiency, which underscores the neuromuscular disorder SMA, affects TMEM41B/Stasimon U12 splicing and mRNA expression (2,3).
1. Stavoe, A. K. H., & Holzbaur, E. L. F. (2019). Autophagy in Neurons. Annual Review of Cell and Developmental Biology. https://doi.org/10.1146/annurev-cellbio-100818-125242
2. Doktor, T. K., Hua, Y., Andersen, H. S., Br0ner, S., Liu, Y. H., Wieckowska, A., Andresen, B. S. (2017). RNA-sequencing of a mouse-model of spinal muscular atrophy reveals tissue-wide changes in splicing of U12-dependent introns. Nucleic Acids Research. https://doi.org/10.1093/nar/gkw731
3. Hosseinibarkooie, S., Schneider, S., & Wirth, B. (2017). Advances in understanding the role of disease-associated proteins in spinal muscular atrophy. Expert Review of Proteomics. https://doi.org/10.1080/14789450.2017.1345631
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pm, Rt, Xp, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, WB
Publications for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP) (0)
There are no publications for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP) (0)
There are no reviews for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP) (0)
Additional TMEM41B Products
Research Areas for TMEM41B Recombinant Protein Antigen (NBP1-81552PEP)
Find related products by research area.
|
Blogs on TMEM41B