TMEM184B Antibody


Immunocytochemistry/ Immunofluorescence: TMEM184B Antibody [NBP1-86810] - Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & golgi apparatus.
Immunohistochemistry-Paraffin: TMEM184B Antibody [NBP1-86810] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Reactivity Hu, Mouse, RatSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

TMEM184B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:TMNPHDIVQDAIHNFSPAYQQYTQQSTLEPGPTWRGGAHGLSRSHSLSGARDNEKTLLLSSDDEF
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
TMEM184B Protein (NBP1-86810PEP)

Alternate Names for TMEM184B Antibody

  • DKFZp586A1024
  • DKFZp686F07174
  • DKFZp686N1150
  • FM08
  • PSEC0108
  • transmembrane protein 184B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM184B Antibody (NBP1-86810) (0)

There are no publications for TMEM184B Antibody (NBP1-86810).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM184B Antibody (NBP1-86810) (0)

There are no reviews for TMEM184B Antibody (NBP1-86810). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEM184B Antibody (NBP1-86810) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TMEM184B Antibody Products

Bioinformatics Tool for TMEM184B Antibody (NBP1-86810)

Discover related pathways, diseases and genes to TMEM184B Antibody (NBP1-86810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM184B

There are no specific blogs for TMEM184B, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol TMEM184B

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-86810 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought