TMEM184B Antibody


Immunocytochemistry/ Immunofluorescence: TMEM184B Antibody [NBP1-86810] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: TMEM184B Antibody [NBP1-86810] - Staining of human kidney shows strong cytoplasmic positivity in cells of tubules.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TMEM184B Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TMNPHDIVQDAIHNFSPAYQQYTQQSTLEPGPTWRGGAHGLSRSHSLSGARDNEKTLLLSSDDEF
Specificity of human TMEM184B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TMEM184B Protein (NBP1-86810PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TMEM184B Antibody

  • DKFZp586A1024
  • DKFZp686F07174
  • DKFZp686N1150
  • FM08
  • PSEC0108
  • transmembrane protein 184B


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM184B Antibody (NBP1-86810) (0)

There are no publications for TMEM184B Antibody (NBP1-86810).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM184B Antibody (NBP1-86810) (0)

There are no reviews for TMEM184B Antibody (NBP1-86810). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TMEM184B Antibody (NBP1-86810) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TMEM184B Products

Bioinformatics Tool for TMEM184B Antibody (NBP1-86810)

Discover related pathways, diseases and genes to TMEM184B Antibody (NBP1-86810). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM184B

There are no specific blogs for TMEM184B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM184B Antibody and receive a gift card or discount.


Gene Symbol TMEM184B