TMEM178 Antibody

Images

 
Western Blot: TMEM178 Antibody [NBP1-69634] - This Anti-MGC33926 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM178 Antibody Summary

Immunogen
Synthetic peptides corresponding to MGC33926 The peptide sequence was selected from the middle region of MGC33926. Peptide sequence RLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM178A
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MGC33926 and was validated on Western blot.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM178 Antibody

  • MGC33926
  • transmembrane protein 178

Background

The function remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM178 Antibody (NBP1-69634) (0)

There are no publications for TMEM178 Antibody (NBP1-69634).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM178 Antibody (NBP1-69634) (0)

There are no reviews for TMEM178 Antibody (NBP1-69634). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM178 Antibody (NBP1-69634) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM178 Products

Bioinformatics Tool for TMEM178 Antibody (NBP1-69634)

Discover related pathways, diseases and genes to TMEM178 Antibody (NBP1-69634). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM178

There are no specific blogs for TMEM178, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM178 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM178A
Uniprot