TMEM168 Antibody


Western Blot: TMEM168 Antibody [NBP1-70727] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB

Order Details

TMEM168 Antibody Summary

Synthetic peptides corresponding to TMEM168(transmembrane protein 168) The peptide sequence was selected from the C terminal of TMEM168. Peptide sequence EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Canine (100%), Equine (100%), Rabbit (100%), Guinea Pig (100%), Bovine (100%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMEM168 and was validated on Western blot.
Read Publication using
NBP1-70727 in the following applications:

  • WB
    1 publication

Reactivity Notes

Use in Mouse reported in scientific literature (PMID:32175648).

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM168 Antibody

  • FLJ13576
  • transmembrane protein 168


TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM168 Antibody (NBP1-70727)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for TMEM168 Antibody (NBP1-70727) (0)

There are no reviews for TMEM168 Antibody (NBP1-70727). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM168 Antibody (NBP1-70727) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TMEM168 Products

Bioinformatics Tool for TMEM168 Antibody (NBP1-70727)

Discover related pathways, diseases and genes to TMEM168 Antibody (NBP1-70727). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM168

There are no specific blogs for TMEM168, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM168 Antibody and receive a gift card or discount.


Gene Symbol TMEM168