TMEM168 Antibody

Images

 
Western Blot: TMEM168 Antibody [NBP1-70727] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM168 Antibody Summary

Immunogen
Synthetic peptides corresponding to TMEM168(transmembrane protein 168) The peptide sequence was selected from the C terminal of TMEM168. Peptide sequence EEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVKAVYGVSKRWSDYTL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM168
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TMEM168 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM168 Antibody

  • FLJ13576
  • transmembrane protein 168

Background

TMEM168 is a multi-pass membrane protein. It belongs to the TMEM168 family. The exact function of TMEM168 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TMEM168 Antibody (NBP1-70727) (0)

There are no publications for TMEM168 Antibody (NBP1-70727).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM168 Antibody (NBP1-70727) (0)

There are no reviews for TMEM168 Antibody (NBP1-70727). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM168 Antibody (NBP1-70727) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM168 Products

TMEM168 NBP1-70727

Bioinformatics Tool for TMEM168 Antibody (NBP1-70727)

Discover related pathways, diseases and genes to TMEM168 Antibody (NBP1-70727). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TMEM168

There are no specific blogs for TMEM168, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM168 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM168