Recombinant Human THEG Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human THEG Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-379 of Human THEG full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGDSRRRSLGNQPSSEAAGRSEREQDGDPRGLQSSVYESRRVTDPERQDLDNAELGPEDPEEELPPEEVAGEEFPETLDPKEALSELERVLDKDLEEDIPEISRLSISQKLPSTTMTKARKRRRRRRLMELAEPKINWQVLKDRKGRCGKGYAWISPCKMSLHFCLCWPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPVWPIPRSSLEYRASSRLKELAAPKIRDNFWSMPMSEVSQVSRAAQMAVPSSRILQLSKPKAPATLLEEWDPVPKPKPHVSDHNRLLHLARPKAQSDKCVPDRDPRWEVLDVTKKVVASPRIISLAKPKVRKGLNEGYDRRPLASMSLPPPKASPEKCDQPRPGL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
THEG

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human THEG Protein

  • CT56Cancer/testis antigen 56
  • MGC26138
  • testis-specific
  • Theg homolog (mouse)
  • Theg homolog

Background

THEG( AAH28574, 1 a.a. - 380 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45545
Species: Hu
Applications: WB, IHC
NBP1-86139
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5447
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00051298-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for THEG Recombinant Protein (H00051298-P01) (0)

There are no publications for THEG Recombinant Protein (H00051298-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THEG Recombinant Protein (H00051298-P01) (0)

There are no reviews for THEG Recombinant Protein (H00051298-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for THEG Recombinant Protein (H00051298-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional THEG Products

Bioinformatics Tool for THEG Recombinant Protein (H00051298-P01)

Discover related pathways, diseases and genes to THEG Recombinant Protein (H00051298-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for THEG Recombinant Protein (H00051298-P01)

Discover more about diseases related to THEG Recombinant Protein (H00051298-P01).
 

Pathways for THEG Recombinant Protein (H00051298-P01)

View related products by pathway.

PTMs for THEG Recombinant Protein (H00051298-P01)

Learn more about PTMs related to THEG Recombinant Protein (H00051298-P01).

Blogs on THEG

There are no specific blogs for THEG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human THEG Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol THEG