Testis expressed 264 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Testis expressed 264 Antibody [NBP1-89866] - Staining of human cell line U-251 MG shows localization to nucleoli & cytosol. Antibody staining is shown in green.

Analysis in human testis and skeletal muscle tissues using NBP1-89866 antibody. Corresponding TEX264 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Testis expressed 264 Antibody [NBP1-89866] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human kidney shows weak cytoplasmic positivity in cells in tubules.

Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Testis expressed 264 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AIDTQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEGEGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TEX264
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot Reactivity reported in (PMID: 31006538).
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Testis expressed 264 Protein (NBP1-89866PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Testis expressed 264 Antibody - BSA Free

• DKFZp451H0417
• Putative secreted protein Zsig11
• SIG11
• testis expressed 264
• testis expressed gene 264
• testis expressed sequence 264
• testis-expressed sequence 264 protein
• ZSIG11FLJ13935

Background

Testis expressed 264 is expressed in testis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Testis expressed 264 Antibody (NBP1-89866)(8)

Publications using NBP1-89866

• Xiaoting Zhou, You-Kyung Lee, Xianting Li, Henry Kim, Carlos Sanchez-Priego, Xian Han, Haiyan Tan, Suiping Zhou, Yingxue Fu, Kerry Purtell, Qian Wang, Gay R. Holstein, Beisha Tang, Junmin Peng, Nan Yang, Zhenyu Yue Integrated proteomics reveals autophagy landscape and an autophagy receptor controlling PKA-RI complex homeostasis in neurons Nature Communications 2024-04-10 [PMID: 38600097]
• Kuci?ska MK, Fedry J, Galli C et al. TMX4-driven LINC complex disassembly and asymmetric autophagy of the nuclear envelope upon acute ER stress Nature communications 2023-06-13 [PMID: 37311770] (Mouse)
  
  Details:
  Immunogold electron microscopy
• Ikeda R, Noshiro D, Morishita H, Takada S et Al. Phosphorylation of phase-separated p62 bodies by ULK1 activates a redox-independent stress response EMBO J 2023-06-12 [PMID: 37306101]
• Kurusu R, Fujimoto Y, Morishita H et al. Integrated proteomics identifies p62-dependent selective autophagy of the supramolecular vault complex Developmental cell 2023-05-09 [PMID: 37192622]
• Wrobel L, Hill SM, Djajadikerta A et al. Compounds activating VCP D1 ATPase enhance both autophagic and proteasomal neurotoxic protein clearance Nature communications 2022-07-16 [PMID: 35842429] (WB, Human)
  
  Details:
  Supplementary fig. 3, Dilution 1:1000
• Chino H, Yamasaki A, Ode KL et al. Phosphorylation by casein kinase 2 enhances the interaction between ER-phagy receptor TEX264 and ATG8 proteins EMBO reports 2022-04-13 [PMID: 35417087] (WB, Human)
• Nthiga TM, Kumar Shrestha B, Sjottem E et al. CALCOCO1 acts with VAMP-associated proteins to mediate ER-phagy EMBO J. 2020-06-11 [PMID: 32525583]
• Chino, H;Hatta, T;Natsume, T;Mizushima, N; Intrinsically Disordered Protein TEX264 Mediates ER-phagy Mol. Cell 2019-04-11 [PMID: 31006538] (WB, Human)

Bioinformatics

• Gene Symbol: TEX264