Testis expressed 264 Antibody

Images

 
Western Blot: testis expressed 264 Antibody [NBP1-69517] - This Anti-TEX264 antibody was used in Western Blot of COLO205 tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Testis expressed 264 Antibody Summary

Immunogen
Synthetic peptides corresponding to TEX264(testis expressed 264) The peptide sequence was selected from the middle region of TEX264. Peptide sequence SIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TEX264
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TEX264 and was validated on Western blot.
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Testis expressed 264 Antibody

  • DKFZp451H0417
  • Putative secreted protein Zsig11
  • SIG11
  • testis expressed 264
  • testis expressed gene 264
  • testis expressed sequence 264
  • testis-expressed sequence 264 protein
  • ZSIG11FLJ13935

Background

The specific function of Testis expressed 264 is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Testis expressed 264 Antibody (NBP1-69517) (0)

There are no publications for Testis expressed 264 Antibody (NBP1-69517).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Testis expressed 264 Antibody (NBP1-69517) (0)

There are no reviews for Testis expressed 264 Antibody (NBP1-69517). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Testis expressed 264 Antibody (NBP1-69517) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Testis expressed 264 Products

Bioinformatics Tool for Testis expressed 264 Antibody (NBP1-69517)

Discover related pathways, diseases and genes to Testis expressed 264 Antibody (NBP1-69517). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Testis expressed 264

There are no specific blogs for Testis expressed 264, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Testis expressed 264 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TEX264
Uniprot