![Western Blot: TEAD (pan) Antibody (3Q10Q8) [NBP3-16550] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with TEAD4 using TEAD1/2/3/4 mAb at 1:1000 dilution. Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection:ECL Basic Kit .Exposuretime: 10s.](http://images.novusbio.com/fullsize/nbp3-16550_rabbit-tead-pan-mab-3q10q8-7220251245384.jpg "Western Blot: TEAD (pan) Antibody (3Q10Q8) [NBP3-16550] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with TEAD4 using TEAD1/2/3/4 mAb at 1:1000 dilution. Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection:ECL Basic Kit .Exposuretime: 10s.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 3Q10Q8 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Novus Biologicals Rabbit TEAD (pan) Antibody (3Q10Q8) (NBP3-16550) is a recombinant monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 174-263 of human TEAD4 (NP_003204.2). SHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLE |
| Source | HEK293 |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | TEAD1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TEAD1 |
![Western Blot: TEAD (pan) Antibody (3Q10Q8) [NBP3-16550] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with TEAD2 using TEAD1/2/3/4 mAb at 1:1000 dilution. Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection:ECL Basic Kit .Exposuretime: 20s.](http://images.novusbio.com/fullsize/nbp3-16550_rabbit-tead-pan-mab-3q10q8-72202512435327.jpg "Western Blot: TEAD (pan) Antibody (3Q10Q8) [NBP3-16550] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with TEAD2 using TEAD1/2/3/4 mAb at 1:1000 dilution. Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection:ECL Basic Kit .Exposuretime: 20s.")
![Western Blot: TEAD (pan) Antibody (3Q10Q8) [NBP3-16550] - Western blot analysis of lysates from wild type (WT) and 293F cells transfected with TEAD3 using TEAD1/2/3/4 mAb at 1:1000 dilution. Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection:ECL Basic Kit .Exposuretime: 10s.](http://images.novusbio.com/fullsize/nbp3-16550_rabbit-tead-pan-mab-3q10q8-72202512435357.jpg "Western Blot: TEAD (pan) Antibody (3Q10Q8) [NBP3-16550] - Western blot analysis of lysates from wild type (WT) and 293F cells transfected with TEAD3 using TEAD1/2/3/4 mAb at 1:1000 dilution. Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection:ECL Basic Kit .Exposuretime: 10s.")
![Western Blot: TEAD (pan) Antibody (3Q10Q8) [NBP3-16550] - Western blot analysis of various lysates using TEAD1 Rabbit mAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1min.](http://images.novusbio.com/fullsize/nbp3-16550_rabbit-tead-pan-mab-3q10q8-7220251245396.jpg "Western Blot: TEAD (pan) Antibody (3Q10Q8) [NBP3-16550] - Western blot analysis of various lysates using TEAD1 Rabbit mAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1min.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")