ST8SIA-VI Antibody

Images

 
Western Blot: ST8SIA-VI Antibody [NBP1-70716] - HT1080 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST8SIA-VI Antibody Summary

Immunogen
Synthetic peptides corresponding to ST8SIA6(ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6) The peptide sequence was selected from the middle region of ST8SIA6. Peptide sequence LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST8SIA6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ST8SIA6 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ST8SIA-VI Antibody

  • 8-sialyltransferase)
  • alpha-2,8-sialyltransferase 8F variant 2
  • alpha-2,8-sialyltransferase 8F
  • SIA8F
  • Sialyltransferase 8F
  • sialytransferase St8Sia VI
  • SIAT8F
  • ST8 alpha-2,8-Sialyltransferase 6
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6
  • ST8Sia VI
  • ST8SIA6
  • ST8SiaVI
  • ST8SIA-VI

Background

Sialic acid is a key determinate of oligosaccharide structures involved in cell-cell communication, cell-substrate interaction, adhesion, and protein targeting. ST8SIA6 belongs to a family of sialyltransferases (EC 2.4.99.8) that synthesize sialylglycocon

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for ST8SIA-VI Antibody (NBP1-70716) (0)

There are no publications for ST8SIA-VI Antibody (NBP1-70716).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST8SIA-VI Antibody (NBP1-70716) (0)

There are no reviews for ST8SIA-VI Antibody (NBP1-70716). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST8SIA-VI Antibody (NBP1-70716) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST8SIA-VI Products

Bioinformatics Tool for ST8SIA-VI Antibody (NBP1-70716)

Discover related pathways, diseases and genes to ST8SIA-VI Antibody (NBP1-70716). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ST8SIA-VI

There are no specific blogs for ST8SIA-VI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST8SIA-VI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST8SIA6
Entrez