SPNS3 Antibody

Images

 
Western Blot: SPNS3 Antibody [NBP3-10204] - Western blot analysis of SPNS3 in Mouse Kidney lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPNS3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse SPNS3 (NP_084208.1). Peptide sequence RGTAEALQITVAHVLGDAGSPYLTGLISSVLQAERPDSYLQHFLSLQHSF
Clonality
Polyclonal
Host
Rabbit
Gene
SPNS3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for SPNS3 Antibody

  • MGC29671
  • protein spinster homolog 3
  • spinster homolog 3 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00283238-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-93466
Species: Hu
Applications: IHC, IHC-P
NBP3-10167
Species: Mu
Applications: WB
NBP1-91154
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-84104
Species: Hu
Applications: IHC, IHC-P
NBP1-51684
Species: Hu, Mu
Applications: EM, ELISA, Flow, ICC/IF, IHC, WB
NBP1-81750
Species: Hu
Applications: IHC, IHC-P
NBP3-10204
Species: Mu
Applications: WB

Publications for SPNS3 Antibody (NBP3-10204) (0)

There are no publications for SPNS3 Antibody (NBP3-10204).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPNS3 Antibody (NBP3-10204) (0)

There are no reviews for SPNS3 Antibody (NBP3-10204). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPNS3 Antibody (NBP3-10204) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPNS3 Products

Array NBP3-10204

Bioinformatics Tool for SPNS3 Antibody (NBP3-10204)

Discover related pathways, diseases and genes to SPNS3 Antibody (NBP3-10204). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for SPNS3 Antibody (NBP3-10204)

View related products by pathway.

Blogs on SPNS3

There are no specific blogs for SPNS3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPNS3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPNS3