SLC38A9 Antibody

Images

 
Western Blot: SLC38A9 Antibody [NBP1-69235] - Lane 1: HepG2, Lane 2: HeLa, Lane 3: HEK293T (25 ug loaded per lane)Concentration of antibody: 1 ug/ml
Western Blot: SLC38A9 Antibody [NBP1-69235] - This Anti-FLJ90709 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 1ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC38A9 Antibody Summary

Immunogen
Synthetic peptides corresponding to FLJ90709 The peptide sequence was selected from the middle region of FLJ90709. Peptide sequence VLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC38A9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FLJ90709 and was validated on Western blot.
Theoretical MW
64 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-69235.

Reactivity Notes

This antibody recognizes multiple isoforms

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC38A9 Antibody

  • FLJ46104
  • FLJ90709
  • MGC120544
  • putative sodium-coupled neutral amino acid transporter 9
  • solute carrier family 38, member 9

Background

The exact function of FLJ90709 remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SLC38A9 Antibody (NBP1-69235)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for SLC38A9 Antibody (NBP1-69235) (0)

There are no reviews for SLC38A9 Antibody (NBP1-69235). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC38A9 Antibody (NBP1-69235) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC38A9 Products

Bioinformatics Tool for SLC38A9 Antibody (NBP1-69235)

Discover related pathways, diseases and genes to SLC38A9 Antibody (NBP1-69235). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on SLC38A9

There are no specific blogs for SLC38A9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC38A9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC38A9
Uniprot