![Western Blot: SLC35A5 Antibody [NBP2-88300] - Host: Rabbit. Target Name: SLC35A5. Sample Tissue: Human Du145 Whole Cell lysates. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize/SLC35A5-Antibody-Western-Blot-NBP2-88300-img0001.jpg "Western Blot: SLC35A5 Antibody [NBP2-88300] - Host: Rabbit. Target Name: SLC35A5. Sample Tissue: Human Du145 Whole Cell lysates. Antibody Dilution: 1ug/ml")
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of human SLC35A5. Peptide sequence: NASKPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDT The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC35A5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SLC35A5 |
![Immunohistochemistry CCL21/6Ckine Antibody [Unconjugated]](https://images.novusbio.com/images2/CCL21_AF457_Immunohistochemistry_10649.jpg)
![Intracellular Staining by Flow Cytometry CCL21/6Ckine Antibody [Unconjugated]](https://images.novusbio.com/images2/CCL21_AF457_Flow_Cytometry_11940.jpg)
![Neutralization CCL21/6Ckine Antibody [Unconjugated]](https://images.novusbio.com/images2/CCL21_AF457_Block_Neutralize_8883.jpg)
