SARS-CoV-2 ORF8 Antibody - Azide and BSA Free Summary
| Immunogen |
Sequence: MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
ORF8 |
| Purity |
Antigen Affinity-purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA 1:4000-1:8000
- Western Blot
|
| Theoretical MW |
13 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.4), 50% Glycerol |
| Preservative |
0.05% Proclin 300 |
| Purity |
Antigen Affinity-purified |
Alternate Names for SARS-CoV-2 ORF8 Antibody - Azide and BSA Free
Background
SARS-CoV-2 Open Reading Frame 8 (ORF8) is one of the nine downstream accessory protein open reading frames of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 ORF8 is 121 amino acids (aa) in length with a theoretical molecular weight of 13.8 kDa (2, 3). One particular difference between SARS-CoV-2 and SARS-CoV is that SARS-CoV-2 has one ORF8 protein, while SARS-CoV has two ORF8 proteins (ORF8a and ORF8b) (3). The aa sequence alignment of SARS-CoV-2's ORF8 has 31.7% sequence identity and 70.7% sequence similarity with SARS-CoV ORF8a (3). Furthermore, SARS-CoV-2 ORF8 has a 40.5% sequence identity and 66.7% sequence similarity is with SARS-CoV ORF8b (3). Despite this low sequence identity and similarity, the ORF8 structure and function appears to be well conserved (4). Both ORF8 proteins appear to be localized to the ER and have an N-terminal hydrophobic region, a conserved glycosylation site, and cysteine residues capable of forming disulfide bonds (4).
Studies have revealed that SARS-CoV-2 ORF8 has a role in host immune suppression during viral infection as it is an inhibitor of the type I interferon pathway (4, 5). Specifically, ORF8 has been shown to have antagonistic properties on interferon-beta (IFN-beta), the NF-kappabeta-responsive promoter, and the interferon-stimulated response element (ISRE) (4,5). Additionally, ORF8 colocalizes with the ER and lysosomal proteins Calnexin and LAMP1, playing a role in major histocompatibility complex class I (MHC-I) downregulation and degradation (4, 6). These results suggest that inhibiting ORF8 may be a potential approach for improving immune surveillance and more quickly eliminating SARS-CoV-2 infection (4-6).
References
1. Michel, C. J., Mayenr, C., Poch, O., & Thompson, J. D. (2020). Characterization of accessory genes in coronavirus genomes. Virology journal. https://doi.org/10.1186/s12985-020-01402-1
2. UniProt (P0DTC8)
3. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The protein journal. https://doi.org/10.1007/s10930-020-09901-4
4. Mohammad, S., Bouchama, A., Mohammad Alharbi, B., Rashid, M., Saleem Khatlani, T., Gaber, N. S., & Malik, S. S. (2020). SARS-CoV-2 ORF8 and SARS-CoV ORF8ab: Genomic Divergence and Functional Convergence. Pathogens (Basel, Switzerland). https://doi.org/10.3390/pathogens9090677
5. Li, J. Y., Liao, C. H., Wang, Q., Tan, Y. J., Luo, R., Qiu, Y., & Ge, X. Y. (2020). The ORF6, ORF8 and nucleocapsid proteins of SARS-CoV-2 inhibit type I interferon signaling pathway. Virus research. https://doi.org/10.1016/j.virusres.2020.198074
6. Zhang Y., Zhang J., Chen Y., Luo B., Yuan Y., Huang F., Yang T., Yu F., Liu J., Liu B., et al. (2020). The ORF8 Protein of SARS-CoV-2 Mediates Immune Evasion through Potently Downregulating MHC-I. bioRxiv. https://doi.org/10.1101/2020.05.24.111823.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Publications for SARS-CoV-2 ORF8 Antibody (NBP3-07972)(3)
Showing Publications 1 -
3 of 3.
| Publications using NBP3-07972 |
Applications |
Species |
| Lett MJ, Otte F, Hauser D et al. High protection and transmission-blocking immunity elicited by single-cycle SARS-CoV-2 vaccine in hamsters NPJ Vaccines 2024-10-30 [PMID: 39472701] |
|
|
| Enja Tatjana Kipfer, David Hauser, Martin J Lett, Fabian Otte, Lorena Urda, Yuepeng Zhang, Christopher MR Lang, Mohamed Chami, Christian Mittelholzer, Thomas Klimkait, John W Schoggins, Diane M Harper Rapid cloning-free mutagenesis of new SARS-CoV-2 variants using a novel reverse genetics platform eLife 2023-11-21 [PMID: 37988285] |
|
|
| Kipfer E, Hauser D, Lett M et al. Rapid cloning-free mutagenesis of new SARS-CoV-2 variants using a novel reverse genetics platform bioRxiv 2023-05-13 [PMID: 37292682] |
|
|
Reviews for SARS-CoV-2 ORF8 Antibody (NBP3-07972) (0)
There are no reviews for SARS-CoV-2 ORF8 Antibody (NBP3-07972).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SARS-CoV-2 ORF8 Antibody (NBP3-07972) (0)