SARS-CoV-2 ORF8 Antibody - Azide and BSA Free

Images

 
Western Blot: SARS-CoV-2 ORF8 Antibody [NBP3-07972] - Various lysates were subjected to SDS-PAGE followed by western blot with SARS-CoV-2 (2019-nCoV) ORF8 Protein antibody at dilution of 1:1000.

Product Details

Summary
Reactivity VSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

SARS-CoV-2 ORF8 Antibody - Azide and BSA Free Summary

Immunogen
Sequence: MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIELCVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDFI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ORF8
Purity
Antigen Affinity-purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:4000-1:8000
  • Western Blot
Theoretical MW
13 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using NBP3-07972.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4), 50% Glycerol
Preservative
0.05% Proclin 300
Purity
Antigen Affinity-purified

Alternate Names for SARS-CoV-2 ORF8 Antibody - Azide and BSA Free

  • 2019-nCoV ORF8 Protein
  • 2019-nCoV ORF8
  • COVID-19 Non-structural protein 8
  • COVID-19 ns8
  • COVID-19 ORF8
  • Human coronavirus ORF8 Protein
  • Non-structural protein 8
  • ns8
  • ORF8 protein
  • SARS-CoV-2 Non-structural protein 8
  • SARS-CoV-2 ns8
  • SARSCoV2 ORF8 Protein
  • SARS-CoV-2 ORF8 Protein
  • SARS-CoV-2
  • Severe Acute Respiratory Syndrome Coronavirus 2 ORF8 Protein

Background

SARS-CoV-2 Open Reading Frame 8 (ORF8) is one of the nine downstream accessory protein open reading frames of severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2), the causative agent of COVID-19 (1). SARS-CoV-2 ORF8 is 121 amino acids (aa) in length with a theoretical molecular weight of 13.8 kDa (2, 3). One particular difference between SARS-CoV-2 and SARS-CoV is that SARS-CoV-2 has one ORF8 protein, while SARS-CoV has two ORF8 proteins (ORF8a and ORF8b) (3). The aa sequence alignment of SARS-CoV-2's ORF8 has 31.7% sequence identity and 70.7% sequence similarity with SARS-CoV ORF8a (3). Furthermore, SARS-CoV-2 ORF8 has a 40.5% sequence identity and 66.7% sequence similarity is with SARS-CoV ORF8b (3). Despite this low sequence identity and similarity, the ORF8 structure and function appears to be well conserved (4). Both ORF8 proteins appear to be localized to the ER and have an N-terminal hydrophobic region, a conserved glycosylation site, and cysteine residues capable of forming disulfide bonds (4).

Studies have revealed that SARS-CoV-2 ORF8 has a role in host immune suppression during viral infection as it is an inhibitor of the type I interferon pathway (4, 5). Specifically, ORF8 has been shown to have antagonistic properties on interferon-beta (IFN-beta), the NF-kappabeta-responsive promoter, and the interferon-stimulated response element (ISRE) (4,5). Additionally, ORF8 colocalizes with the ER and lysosomal proteins Calnexin and LAMP1, playing a role in major histocompatibility complex class I (MHC-I) downregulation and degradation (4, 6). These results suggest that inhibiting ORF8 may be a potential approach for improving immune surveillance and more quickly eliminating SARS-CoV-2 infection (4-6).

References

1. Michel, C. J., Mayenr, C., Poch, O., & Thompson, J. D. (2020). Characterization of accessory genes in coronavirus genomes. Virology journal. https://doi.org/10.1186/s12985-020-01402-1

2. UniProt (P0DTC8)

3. Yoshimoto F. K. (2020). The Proteins of Severe Acute Respiratory Syndrome Coronavirus-2 (SARS CoV-2 or n-COV19), the Cause of COVID-19. The protein journal. https://doi.org/10.1007/s10930-020-09901-4

4. Mohammad, S., Bouchama, A., Mohammad Alharbi, B., Rashid, M., Saleem Khatlani, T., Gaber, N. S., & Malik, S. S. (2020). SARS-CoV-2 ORF8 and SARS-CoV ORF8ab: Genomic Divergence and Functional Convergence. Pathogens (Basel, Switzerland). https://doi.org/10.3390/pathogens9090677

5. Li, J. Y., Liao, C. H., Wang, Q., Tan, Y. J., Luo, R., Qiu, Y., & Ge, X. Y. (2020). The ORF6, ORF8 and nucleocapsid proteins of SARS-CoV-2 inhibit type I interferon signaling pathway. Virus research. https://doi.org/10.1016/j.virusres.2020.198074

6. Zhang Y., Zhang J., Chen Y., Luo B., Yuan Y., Huang F., Yang T., Yu F., Liu J., Liu B., et al. (2020). The ORF8 Protein of SARS-CoV-2 Mediates Immune Evasion through Potently Downregulating MHC-I. bioRxiv. https://doi.org/10.1101/2020.05.24.111823.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SARS-CoV-2 ORF8 Antibody (NBP3-07972)(3)

Reviews for SARS-CoV-2 ORF8 Antibody (NBP3-07972) (0)

There are no reviews for SARS-CoV-2 ORF8 Antibody (NBP3-07972). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SARS-CoV-2 ORF8 Antibody (NBP3-07972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SARS-CoV-2 ORF8 Products

Blogs on SARS-CoV-2 ORF8.

Early T cell response is associated with mild COVID-19 and rapid SARS-CoV-2 clearance
Jamshed Arslan, Pharm D, PhD SARS-CoV-2 induces both humoral and cellular immunity. A vaccine or natural infection invokes SARS-CoV-2-specific humoral components (antibodies from activated B cells) and cellular resp...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SARS-CoV-2 ORF8 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol ORF8