| Reactivity | VSpecies Glossary |
| Applications | ELISA |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Novus Biologicals Rabbit SARS-CoV-2 ORF7a Antibody - Azide and BSA Free (NBP3-07971) is a polyclonal antibody validated for use in ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Sequence: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ORF7a |
| Purity | Antigen Affinity-purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 13 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4), 50% Glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Antigen Affinity-purified |
Secondary Antibodies |
Isotype Controls |
|
Early T cell response is associated with mild COVID-19 and rapid SARS-CoV-2 clearance Jamshed Arslan, Pharm D, PhD SARS-CoV-2 induces both humoral and cellular immunity. A vaccine or natural infection invokes SARS-CoV-2-specific humoral components (antibodies from activated B cells) and cellular resp... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ORF7a |